DPCstruct | MC13752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 76 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 81.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2LBI5 | 1-93 | MKLPKALNEATAGAALKYHIKRALERSHSISDFSKNLELSVQKSHFSNNTLKIIEELNNGVKQASEEIKEKATKYEKALQELQKIDE… |
| I9YWP6 | 44-142 | IKLPKALNEATAGAALKYHIKRALERSHSISEFSKNLELSAQKSHFSNNTLKIIEELNNGVKQASEEIKEASKKSAEIKRDFSDTKL… |
| K2KTY4 | 8-98 | None |
| A0A2X5AD10 | 1-92 | None |
| A0A293TS28 | 1-77 | None |
| A0A518Y7E1 | 8-72 | None |
| A0A2T6TX92 | 2-66 | None |
| T5DFE0 | 21-83 | None |
| A0A1A9HCY9 | 2-64 | None |
| A0A2T6SFD5 | 76-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.