DPCstruct | MC13751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 163 ± 19 aa |
| Standard deviation of domain lengths | 18.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 12.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B0IFJ0 | 106-260 | NEFLDKGLIDENSNINFLKNNIEKFNILCSLVEKSKNTIFLNQPSIQRIDNVFKENNIYWSYIIPEKSPFPISTKSKIEKKYNFTSK… |
| A0A849V4D0 | 23-202 | YVMHNLVFIAVTAIIILAFCQPGPTTNELASKYKSNPEGFEKLSRLIKEDTGSKSCFVVGLDNIGDYWEYMGKWAHPPDSTINLSLA… |
| A0A2A4Z0U8 | 7-153 | None |
| A0A0D3LB75 | 83-216 | None |
| A0A7V6G3T5 | 203-396 | None |
| A0A2V6XRE3 | 3-176 | None |
| A0A6L4B8E6 | 1-146 | None |
| A0A5S9PHY6 | 1-132 | None |
| A0A4Q3EEC1 | 198-377 | None |
| A0A2U2D5D9 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.