DPCstruct | MC1375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 12.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7L9C1 | 12-100 | FYLELINIFDELSAIDFSQGIESQVMVLDEDLLQLSFKSGVIVDVGWYPAFETNGEFIINRIANSCWDAPEAKYSVGWDKDELISKI… |
| A0A8B4GAR3 | 4-96 | NLNLRNGTITYDNFFWLLEHADSNPADLLLGEDLLQISFCGGQYLLDAGWYGFGPRGQFGVMLVENQDWEHPLRKEYTREISRLPAL… |
| A0A0B5RGX3 | 11-97 | None |
| A0A0M4CWZ7 | 16-125 | None |
| A0A0M4CT37 | 5-112 | None |
| A0A1G5JFN0 | 2-115 | None |
| A0A3M8DWH5 | 5-92 | None |
| A0A7I8DL06 | 327-440 | None |
| K9PNW4 | 5-114 | None |
| A0A7X5YLB5 | 15-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.