DPCstruct | MC13749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6NS11 | 2-100 | RSNDAVHGLYEIREEARNFVDQENARNPQNEWKALDPNLKVLVPRCAVPLKARWHEIWWFDTSAESKLLKRSRRVIAVECTRTASPA… |
| A0A849R0X8 | 21-114 | DITQAGQIHVQGLDEIQQTVDQFVILENQKNNSAWVADNVNNKVLVPKCNVPLSAKWMPKNYGLSRKSIAVICQQTDDKDFKKWDIF… |
| A0A0Q7VN92 | 17-116 | None |
| A0A7W8XRM7 | 3-103 | None |
| A0A366E9R6 | 104-188 | None |
| A0A2V4DTY4 | 27-114 | None |
| A0A1I2M7M3 | 43-121 | None |
| A0A7W8LXX6 | 69-191 | None |
| A0A085HF62 | 15-116 | None |
| A0A2N6IGT9 | 69-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.