DPCstruct | MC13741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 175 ± 21 aa |
| Standard deviation of domain lengths | 21.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839N2R2 | 4-153 | ESTQAMCGDGSPVAVDDGIAICSPSAAYLPACWKSTDSTALCLRNATDKVLVRLPYTGAWGNPTKPSVTSPLNMRLADGDRCQIRVG… |
| A0A4Q3XEV3 | 7-148 | TDPSGFAIADGIFHCGSNAQGLNACWPLSDGTSACLHSAFNRELALIDTPDGSAVKAPASASPFAVQLSDGVRCEVVSHAHHPPRPD… |
| A0A402AUR4 | 6-168 | None |
| A0A7X9CVI9 | 3-120 | None |
| A0A7V4J6T9 | 393-580 | None |
| A0A8A5YSK8 | 5-177 | None |
| A0A0G0W382 | 139-315 | None |
| A0A841A7T1 | 92-272 | None |
| A0A4R1F8Y4 | 5-149 | None |
| A0A495BYY9 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.