DPCstruct | MC13740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 130 ± 22 aa |
| Standard deviation of domain lengths | 22.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A243UWL2 | 3-143 | DVPFGNAGIGYLNEYGSPEQNIPPRPHLVPGVKSAEEQTVPQLKTAAQAALDGNAAGAESALNRAGTLAVNGVRRYMTITGFTPLAD… |
| A0A4V1G433 | 2-120 | QGDEETAMIAGIHEYGSLKAGIPARSFVGTGKKKAQAPISKTVKAGVIELVTGNLNTKDLLQQIGDVGLGRVVKNFDKLRTPPLSPI… |
| A0A7G2RX88 | 23-154 | None |
| A0A511FPH2 | 89-236 | None |
| A0A829I6G1 | 11-127 | None |
| A0A523GQA4 | 15-169 | None |
| A0A843GX64 | 57-161 | None |
| A0A416GU02 | 153-247 | None |
| A0A661DCL0 | 6-134 | None |
| A0A420W5A9 | 19-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.