DPCstruct | MC1374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 141 ± 24 aa |
| Standard deviation of domain lengths | 23.68 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1DIL5 | 151-293 | IAALDRQHPRDLFDVWRLFESGGITDGMLDCFVVYLAGHNRPTHEVLFANEKDIAGEYERAFVGMTEIACPLETLLDARTRLRHELP… |
| A0A3B0VWM9 | 43-181 | CAALDRQHPRDLFDVKLMFENEGFTDEIKRGFLFGLVSSNRPTHEILNPHLLNQHTAFENQFEGMSAIAFSYDDYEATRLQLIETVK… |
| A0A645DZF5 | 6-171 | None |
| A0A662CRB6 | 1-192 | None |
| A0A2G6JEI9 | 27-179 | None |
| A0A6L7RVP1 | 31-156 | None |
| A0A6M1I6B8 | 14-125 | None |
| A0A1N6JR53 | 42-153 | None |
| A0A7Y3WMU5 | 19-114 | None |
| A0A3N0EQ81 | 2-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.