DPCstruct | MC13739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 296 ± 46 aa |
| Standard deviation of domain lengths | 46.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4BY62 | 7-289 | DTLALQQAREEEGAFAGYSKYLEGQNAKALREGFDRRADVQQMIRGAIPLVAEAIKAWVATASGQKGRPSAALAPLKEVDPDVIAYG… |
| A0A433WUB8 | 4-255 | IFRQAQWEMVGVRRAQKIFMEDMERATASGRLHETGPGRRLLRKIVTPLAEEIRNETDKAIAAAGERGRKSVVGDCFMAFTDKHLEV… |
| A0A2P2MDM0 | 215-421 | None |
| A0A0R3U9V8 | 324-643 | None |
| A0A3N7H698 | 1-223 | None |
| M1V872 | 391-692 | None |
| A0A2X1C6J4 | 3-212 | None |
| A0A7S3U9D1 | 1-461 | None |
| A0A5S6Q3H1 | 338-673 | None |
| A0A061RHR9 | 148-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.