DPCstruct | MC13737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 172 ± 36 aa |
| Standard deviation of domain lengths | 36.03 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H0G975 | 46-202 | ELLATQPGSAEEQEVLSEYNRLGCHAPAIGAGILRGAVAEQLFRSDFGSIGARARRDNIEVFTVDMSELEALSDEAKKRIDYVAFGT… |
| A0A4Q7SJI9 | 150-310 | RRQVESFLETWPDSPNYNSMVRRVASNNCIASGDLRMTSSFLRGALYVGLYKIDYKDSPASVSKAPINFGLQMTDASTPNTKVYVSR… |
| A0A841L3M5 | 1-125 | None |
| A3WBY6 | 24-233 | None |
| A0A7G9SDU6 | 1-147 | None |
| A0A0W1QP47 | 18-153 | None |
| A0A6I6LBD0 | 44-208 | None |
| A0A7H0G2F9 | 16-151 | None |
| I9C9Z0 | 19-199 | None |
| A0A4Q3L6B1 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.