DPCstruct | MC13730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U0H7G4 | 4-116 | IDQQIYDADNVIVRNIEALTDQRDLLSQNVLSQLRNLVEGLVARAHQGTGANTFRQSDVGAGLDIVRADARLNVLSRFHHRLQGSTS… |
| A0A825SB88 | 10-121 | ILIQILDIDRNINKNIVRNKEDRGFLSQNILNELRNLLEHIALCIYNTDTNQQLDSIYENLQSSLKYIGDKRKYKDIKNFHNLLQIS… |
| A0A7U7ZCH4 | 10-121 | None |
| A0A0K2RUZ0 | 1-154 | None |
| U2Q8S6 | 1-112 | None |
| M5IS07 | 3-141 | None |
| R9L392 | 1-104 | None |
| U6RFB2 | 1-128 | None |
| F7JIE4 | 1-123 | None |
| A0A562FRR4 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.