DPCstruct | MC1373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 222 ± 17 aa |
| Standard deviation of domain lengths | 17.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6JJ85 | 11-239 | MQQLYAEHHIFLEILFTTSWWLRYLVPSWRRASNRKIVKHMKYPFIPLLAHLTCGTLAMIRYYYLYLALGDSPVPTLLDLAFSLGFT… |
| A0A1E1KT56 | 10-241 | SLISGFLKSNSPELEFAFRLALFAPFLGKTFRLVRPKQTRIRKFPYLPLVIHILCAPAQFLRYYGSYIQTRNLPVPDRLDLLFSGLF… |
| A0A2T3YZG8 | 73-317 | None |
| A0A5N5WUH3 | 2-186 | None |
| A0A0G2FT01 | 19-239 | None |
| A0A1Y2E2I3 | 8-228 | None |
| T5ABP8 | 21-261 | None |
| W7I499 | 3-222 | None |
| A0A1B8BWT0 | 8-217 | None |
| A0A507AQD7 | 33-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.