DPCstruct | MC13728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 148 ± 6 aa |
| Standard deviation of domain lengths | 6.34 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10607 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2FQZ1 | 1-142 | MMSGSVEALCRNLGEDQKEAYHVHAKHSKAIAKRFKADIASDPVQNVILDQRPLVDQAIVMHLLRQGDFANAEAFAREASVARDDKL… |
| A0A1Y2FUM3 | 60-212 | CRNLGEDQKETYNVHAKHSKAIAKRFKADIASDPVQNVIHDQRPLVDQAIVMHLLRQGDFTNAEAFAREASVARDDKLWDAFKVLYE… |
| A0A453SBV2 | 1-154 | None |
| A0A6V7PB34 | 64-215 | None |
| M9MCG4 | 69-207 | None |
| A0A315VMT9 | 329-483 | None |
| A0A433PTM7 | 53-204 | None |
| A0A0V0YHJ7 | 74-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.