DPCstruct | MC13726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 149 ± 26 aa |
| Standard deviation of domain lengths | 25.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2FCZ8 | 3-143 | GPAKETKPRDARLLHLLLTSLNVPQYEEQIPQQLLTFAHNYVASTLQDSLVFQEHRAATTMDTSDVKLAVAAKMSHAFRGAPPKEFL… |
| A0A1Y1X2V7 | 30-152 | QNNSLPRDAKVIKLILKTMGIYNVESRVIQQILEFAHRYTSDVLQDALAFSEHAGHNEVNESDIRLAIEGKTTYSFTNPPSRDVLEE… |
| R1CPI8 | 126-276 | None |
| Q8H5X9 | 14-176 | None |
| A0A0W0DU44 | 2-162 | None |
| A0A0D8Y0X0 | 530-661 | None |
| A0A6G0XAB7 | 18-183 | None |
| A0A3N4IC88 | 31-192 | None |
| A0A6A5X0G0 | 36-200 | None |
| A0A0K0EDN7 | 81-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.