DPCstruct | MC13724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 687 |
|---|---|
| Mean domain length (aa) | 194 ± 39 aa |
| Standard deviation of domain lengths | 38.71 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 13.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2EW92 | 20-220 | AAPSVYASLPQKVPDCIREGLTLLIVGLNPGVLTAKTGLHFASPTNLFWPLLYESNIITRPMKAQEGCACLVNEFDIGITNIIDRPT… |
| A0A4R0INC4 | 220-393 | PVTVARHFAKVPSYADFRELFWHDWGPVFYRGRLNRKARLLAIASDPGPTERVAGRTLVGDAGQRVQGFLAKLGLTRSYALVNAYAY… |
| A0A1Y6BZT2 | 187-368 | None |
| A0A7C1C7K0 | 14-186 | None |
| A0A1H3XZ11 | 1-229 | None |
| A0A1H3XZ66 | 103-357 | None |
| A0A1H6L279 | 17-243 | None |
| A0A1E8Q171 | 317-530 | None |
| A0A2H0DTT0 | 2-129 | None |
| A0A844TBZ5 | 274-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.