DPCstruct | MC13723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 117 ± 6 aa |
| Standard deviation of domain lengths | 5.80 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2EU75 | 2-108 | EFEAMWRENKLTGTPKSVLSDTLSKAIVTLQEELSNSSLWDKAELRNRILRAAFPKLLVDKLSLETLLQRVPDAYIRAIFGSYLASR… |
| Q4CVH4 | 87-209 | ARREFEAIWRDHESHPGMSKTLISDTLSEKNVKVRANILASDVFKNKKLVRYILFHYTPKTLLEVVPVDELMNRVPIAYQHAICAMW… |
| A0A5M9JZ54 | 1094-1216 | None |
| A0A7S1JKJ0 | 5-122 | None |
| A0A6A4GYT7 | 710-824 | None |
| A0A6A4GWL0 | 484-598 | None |
| A0A0L0NW60 | 453-573 | None |
| K2BKF4 | 254-361 | None |
| A0A7S4UFD7 | 981-1106 | None |
| A0A0G4MFP3 | 224-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.