DPCstruct | MC13722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 41.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6EUM2 | 1-60 | MPPAVLRILNFKACRGAIMFGDPLLPSECCLIIEELKATSLCFQCAHGRPTTVPILNIAS |
| A0A1Y2ESN2 | 1-66 | MPTFLFEAIQSRSCRSAIMFNDELDHQQMENLVHALGYCHLPFQCAHGRPSLHSLMVFQEAYNFDP |
| A0A843W4Y3 | 99-155 | None |
| A0A068YFA3 | 74-132 | None |
| A0A2J7ZMF5 | 290-354 | None |
| A0A7R9ZYL0 | 54-118 | None |
| A0A820J8S3 | 27-81 | None |
| A0A067CFS1 | 150-209 | None |
| A0A0N4T6U0 | 208-274 | None |
| A0A7S3YBK3 | 10-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.