DPCstruct | MC13720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 4.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6C655 | 1-60 | MLIDCDTCSVRGKACRDCVVTVILTNPPCPVDLDEAEQDALGSLAGAGLVPPLRLVPDST |
| A0A7W1LNM3 | 1-73 | MLIDCDTCQVRGAACRDCMVTVLLGPPAGLELDEVEQAAVNALAAGGLIPPLRLVPIVTQREAVEAEGKREVG |
| A0A7I7XV43 | 17-80 | None |
| A0A6J4LG34 | 31-98 | None |
| A0A656Y657 | 1-71 | None |
| A0A4R1CYT4 | 1-67 | None |
| A0A2N3WAD8 | 191-251 | None |
| A0A838GLV2 | 1-64 | None |
| A0A7Y1TTN8 | 1-60 | None |
| A0A6L5F3N7 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.