DPCstruct | MC1372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 48.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01679 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423WDR7 | 1-115 | MGIFLERCMLTLVNVFLPPLSVMLVAGVGRDALVNTLWFLCGVIPGHIHGFYITWTYFSRKKKVRKGRYPGGPKPLIYSPRVINGDA… |
| A0A1E1KPH1 | 3-106 | ILERILVFTINIFCPPLSVLLVAGPGTDCLINVLLFIAGVIPGHIHAFYVTCTYFHRKHRVKRGRYPGGRKAGIYSERVWNGGVGRG… |
| W2RMJ6 | 6-124 | None |
| A0A3N2Q8X6 | 1-88 | None |
| A0A1L7WWV8 | 245-328 | None |
| U7Q3X8 | 1-87 | None |
| A0A0G4M483 | 38-131 | None |
| A0A6G1I4L5 | 708-800 | None |
| A0A4Y8DG18 | 57-151 | None |
| A0A517KYZ5 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.