DPCstruct | MC13718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Standard deviation of domain lengths | 11.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1SRS4 | 145-215 | AAQLVDIVRGLRALELRKAPSISETIDWARTLAVLGVEELTATVLSDTASVVVKYDKDVRKAIGAMPRLVD |
| A0A7W1LKQ7 | 2-70 | QLAEQLVRTVRALRSLELKKSPSIAETLDWAHTLLALGLSTLDEAAVRSTLGVVLKHASDQERAAIELR |
| A0A7Y2QC61 | 126-217 | None |
| A0A6J6DAC1 | 12-82 | None |
| A0A6G3VSM9 | 77-148 | None |
| A0A6J5YJP2 | 2-70 | None |
| A0A8A6S360 | 223-313 | None |
| A0A7W0RI52 | 2-89 | None |
| A0A842L535 | 8-69 | None |
| A0A523H496 | 53-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.