DPCstruct | MC13715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 8.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9XHY3 | 21-85 | VVLPCLSGQDCPGSYACAILTGEDLDNHDHNFFRVLLIYSRPSFTALRCYSSNTAHWGLERRKPG |
| A0A0E0DES0 | 1-92 | MTGDMSILLPVLSEKDRPGLYACALLTADDLQDSVDPLPSGPAAFRLLVLYKRRSFTACRSYSSDTKAWSTERKLSSGTDLAAGAAA… |
| A0A835AGL4 | 202-267 | None |
| A0A1E5VZJ0 | 67-142 | None |
| A0A1E5VNE0 | 1-77 | None |
| A0A0P0XT33 | 99-168 | None |
| A0A811QL01 | 203-267 | None |
| A0A811SP21 | 1-82 | None |
| A0A0E0B903 | 1-85 | None |
| A0A835BCF0 | 192-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.