DPCstruct | MC13712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7LXN2 | 1-76 | MVKRRIMVPVEDIDLNSVKYEHEEITAPHVTGLVLKLFVWILELPLLGSLILAVIKKQNKLTQLLRNTVIPEAPMF |
| A0A0E0D9V8 | 2-77 | GKPPRAMTPVEEVDLSAVRYQSPSLQAPHLTGFSLRAFVWLMESPLFGRLLTSVLKSQNNITRMLQDTVIPERPMY |
| A0A452XQ33 | 2-73 | None |
| A0A452ZZH4 | 4-97 | None |
| A0A7J8YRG3 | 1-84 | None |
| A0A6J5VRE2 | 1-84 | None |
| A0A833Y9U8 | 5-88 | None |
| A0A0A9LVN2 | 10-92 | None |
| A0A835HU82 | 1-85 | None |
| A0A453AC69 | 60-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.