DPCstruct | MC1371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 213 |
|---|---|
| Mean domain length (aa) | 243 ± 48 aa |
| Standard deviation of domain lengths | 47.84 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.84 |
| Pfam Score | 65.45 |
| Assigned Pfam label(s) | PF04479- CL0016- PF06985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1KF52 | 18-238 | VVRFYSALSLTYENDRLPALSGIASSLISNSNYLAGLRRQSLVFDLNWMHLGTLGSVAKESGVPSWSWAAIKSSVEFFPYEKLNPRL… |
| A0A2T2N0I5 | 130-323 | IHFLFEEYSKRGLTKETDRCVAISGLEARIARARECEKRYGVFQQFLHRNLLWQPSEKKLDQISYDKKSVPSWSWMAYNGGIQFMDI… |
| A0A2J6Q113 | 430-701 | None |
| N1R9R4 | 349-602 | None |
| A0A423WTS7 | 826-1060 | None |
| A0A4Z1PI25 | 783-1031 | None |
| A0A162N332 | 188-434 | None |
| A0A5Q3FDI4 | 444-693 | None |
| A0A5Q3FRU3 | 920-1247 | None |
| A0A367LCS1 | 787-1078 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.