DPCstruct | MC13708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 95 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.12 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF10974- PF00239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0N518 | 5-96 | EREITEPVDLCLPGGRLNPEAVGWTRRPLHRANLRGWGRAKRWEYWGVVTPSHVIALVASSLDYAGVHGVYVLDRATGAEVSHDAVV… |
| A0A3C0DMT6 | 7-103 | LRSLYYDEPELTGLAQQLCDTRGRLNPTSIGWSRQPLHHCNLSGHWARKKRWNYWCAADQTRLFSVTVSNLDYAAMIFAYYLDFQTL… |
| A0A841D4X4 | 5-96 | None |
| A0A5C8YFX4 | 11-101 | None |
| A0A660XGH4 | 2-95 | None |
| Q67RW4 | 4-96 | None |
| A0A1F8P5U8 | 1-104 | None |
| A0A1V9IUR8 | 8-100 | None |
| A0A1L6LVH1 | 128-225 | None |
| A0A3S9WJM5 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.