DPCstruct | MC13704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 88 ± 4 aa |
| Standard deviation of domain lengths | 4.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15540 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F3CDV3 | 53-138 | DLAFQKTGVSRSEFSVTKWAKDKNGKSFPVEYRVLSGKNRGAEVNIDMGHTKPGTPGSPHIGWQTPGKNNIVGHIFVDKVDVYRVR |
| A0A1N7MVF3 | 119-217 | MQEAFKIIEEETGIKKSEFKVTEWAKSKDGKSFPVEWRHEPSGAEVSMDKPHFGFDKNTGQWATGPDAPHIGWQTSGKRKGGGAKRG… |
| A0A3M9YYH7 | 184-272 | None |
| A0A7Y1MG76 | 1-92 | None |
| A0A1E3BUW5 | 1-84 | None |
| N9N2Q7 | 252-335 | None |
| A0A268E0K5 | 367-453 | None |
| A0A081NGI3 | 395-484 | None |
| A0A0J7I7V1 | 158-247 | None |
| A0A7W1WUK5 | 257-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.