DPCstruct | MC13703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 144 ± 15 aa |
| Standard deviation of domain lengths | 15.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7ITR9 | 59-216 | AEFRFREGDMDFRMLISAEEARLYERARRKLKEVKLVHSDPRIHHQWESKKYLTLHDYFTERIQHYYQRRNEDPVALHRTIRFCERQ… |
| A0A7D4BHF9 | 297-463 | ESEDFFHYQDEEFTFSIPWDKDEKEVFQQATEKYEETKKRLNNSAKKMDQHKIQRARYMQYWSLHLHYKDQAQYFYKKRDQEPDALE… |
| A0A2N0F2M2 | 64-194 | None |
| A0A2H6A3L9 | 12-133 | None |
| B5ILS4 | 144-281 | None |
| A0A1I6R6C6 | 117-268 | None |
| A0A366DLR5 | 1-119 | None |
| A0A6L4Z7B1 | 317-476 | None |
| A0A4R7DUZ6 | 6-144 | None |
| A0A850EXT1 | 5-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.