DPCstruct | MC13701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287QC66 | 121-190 | LKLGSKPDAFTRRGQAWFCTTGLPSDVTVEVGEMSFHLHKFPLLSKSAILGRLIEENSDQDECTIKLSDI |
| A0A445A0Q5 | 1-74 | MACVKLGSKPDAFQRQGQAWFCTTGLPSDIVVEVGEMSFHLHKFPLLSKSGVLERLIAEASESKEESVIHLPDI |
| A0A453N4I3 | 22-103 | None |
| A0A7I4DWX1 | 70-143 | None |
| A0A6S7MCB1 | 1-74 | None |
| A0A1D6MTD6 | 1-83 | None |
| A0A396IDT7 | 1-73 | None |
| A0A287QBJ3 | 114-195 | None |
| A0A3Q7Y7Y7 | 2-78 | None |
| A0A445GUA2 | 251-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.