DPCstruct | MC137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Standard deviation of domain lengths | 11.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09701 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4L2K1 | 7-125 | RNSMEQRRAQAAYQDATNGFKQQSKEYVAFVNELPMLIKTNGLGATIAFATYKNDASKMVYRQLENWLKQEVNQYLLPDLQSDKRLI… |
| A0A842VEM4 | 44-180 | TYKGIERGRAQFAYECVEKIINDGQFKHESEYKSYVTNVPMYIKTNGLGAALTFVNAKKTDDNKKKGYAYSKIYEHTFEYIQKFANH… |
| A0A7V4KC06 | 9-125 | None |
| A0A0M2VCD0 | 4-115 | None |
| A0A538RBQ7 | 76-220 | None |
| A0A142BBU4 | 18-156 | None |
| A0A6M0YI04 | 2-138 | None |
| A0A357ZIL5 | 2-129 | None |
| A0A850Q2X0 | 2-142 | None |
| A0A7C2PSZ7 | 132-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.