DPCstruct | MC13696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6BMR9 | 45-119 | QEEVDPSAATAGEPGSCLNEVGAAASAKLVERCIAVSPATHPPCNVANPCAMIQGEIDRSCDMYGPGETKPTQCG |
| B3T3M0 | 14-86 | VFCQVLPAGAGGRNCIDEAGKRHADILVEWCKAVSPATHPPCNTANSCDLIIDEIKRGCAFVRQEEASPYYCQ |
| A0A2P9HB35 | 104-170 | None |
| A0A1S1TB38 | 71-140 | None |
| A0A2V9HP06 | 245-312 | None |
| A0A4U6ATX4 | 96-166 | None |
| A0A1G9AYF2 | 14-86 | None |
| A0A537MA58 | 13-85 | None |
| A0A1Q7SW04 | 85-147 | None |
| A0A4V3LV52 | 216-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.