DPCstruct | MC13694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Standard deviation of domain lengths | 17.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.33 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0660- PF13396 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0DLX6 | 12-137 | PVLGAFWTMMWIFLWVMWLFLLFRIVFDIFRDDSMSGWAKAGWLLFVLVLPFLGCLVYLLARGKDMGKREIEQARAQQKAFESYIRQ… |
| A0A3D4WWW0 | 1-98 | MDFWDVFWLLLIFIPLLLIWGFAIVDIFRRDDIEGWVKALWIVLVVFAPFLGTLIYLIFRPTGATREEREHDLKLLSDLHDRGKLTD… |
| A0A4Q5J3F1 | 1-151 | None |
| I4EXV6 | 41-165 | None |
| A0A0J1BQI5 | 1-113 | None |
| A0A7K0RXP2 | 2-117 | None |
| A0A7L7M690 | 513-651 | None |
| A0A359A5S6 | 2-107 | None |
| A0A1I4FAV9 | 1-144 | None |
| A0A523VJQ7 | 7-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.