DPCstruct | MC13692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 52.98 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0023- CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2HCU6 | 115-192 | AGKSFYVHNVNGHVQSRVVYFLMNIHLLPRAIYLTRHGESEYNQLGRLGGDSPLSENGLKYAEKLREYFELTDEKRSS |
| A0A452RT44 | 200-272 | GRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGESEHNLQGKIGGDSGLSSRGRKFANALSKFVEEQNL |
| A0A7J7JF07 | 168-251 | None |
| T1FR44 | 129-205 | None |
| T0NN30 | 302-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.