DPCstruct | MC13691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.70 |
| Pfam Score | 94.74 |
| Assigned Pfam label(s) | PF08337- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401QEN5 | 1-72 | MDSDSISQVKEKILEGFYKNVPFSQWPRVEDVDLECFASSSDSRILRDLDNTSVVEDGRKKLNTVAHCKVRS |
| A0A822E9I4 | 53-120 | NCDTITQVKEKILDTIFKNLPCSHRPKAADMDLEWRQASGARMILQDEDITTKIENDWKRLNVIGHYQ |
| A0A7R8X038 | 607-676 | None |
| A0A1S3QC61 | 84-164 | None |
| A0A2R7W2M5 | 220-291 | None |
| A0A3Q4I2J6 | 111-180 | None |
| S4RGT4 | 20-91 | None |
| T1EDQ9 | 169-240 | None |
| A0A4Z2B526 | 733-801 | None |
| D4AA77 | 1366-1434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.