DPCstruct | MC13690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 143 ± 19 aa |
| Standard deviation of domain lengths | 19.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8DRQ1 | 53-165 | WVKGAFNYVQNLKCEDVFFTTEKECLALLTVTQSSYVVHVAPFSGHRTYETVLPEEVLTRKDNNHQGVLVLDPYPTANFGHLVIVFF… |
| A0A401QBA1 | 20-151 | AEGSQFKAARLHRWSTASLGYLKSSLCQRVSFLSDSECKRLAEIPQPAVAVYAAEPRAGEKLLTILPDSGLSLGSPHDAVITLDPSP… |
| F7B599 | 68-238 | None |
| A0A1Y3EXW3 | 29-166 | None |
| A0A8B6F5U8 | 42-159 | None |
| A0A0V0YDF5 | 29-170 | None |
| B7PH27 | 12-139 | None |
| A0A6F9CEQ8 | 25-166 | None |
| A0A0R3T6C7 | 21-159 | None |
| A0A369S9L0 | 18-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.