DPCstruct | MC1369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 8.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485A4U5 | 21-106 | LPIFKPFITLLANVIERHPKVFSITLNYSNADYTAETGGYRPVEIRLERKQGNHWHICYVTEFTYMATPFGQESTYAIDFDFSREL |
| A0A6I4WK72 | 1-76 | MTPSKPLQTLFAKIISSYPDATALTLNFRSPDYSADTGGYRPVEIRLEKRAGIWGMAYVTEFTYLGGELVKDLDFD |
| A0A7Y4GJN5 | 7-91 | None |
| A0A7T3X296 | 1-80 | None |
| A0A2X2SZ02 | 1-82 | None |
| A0A1Y5H6F7 | 1-94 | None |
| A0A6S5BZ16 | 2-85 | None |
| A0A5F0YIS9 | 2-76 | None |
| A0A8A5WSZ6 | 1-87 | None |
| A0A6S5P6V0 | 11-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.