DPCstruct | MC13689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 60.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7YZS2 | 115-185 | PKNSAEREQKWPEHMEAAFFTALVRWPPIGRRKIMHEGKLRGRNELIADSIEKWTGEARTRKQVSSHIQVL |
| A0A401Q9D1 | 1-97 | MSDTMEKSLDSEAEGVWSPDIEQSFREALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREI… |
| A0A1J8QAT2 | 75-187 | None |
| A0A4U0VTX6 | 158-234 | None |
| A0A6S7H289 | 1-81 | None |
| I7ZY33 | 65-127 | None |
| A0A0L7L523 | 247-339 | None |
| A0A058ZBM4 | 28-124 | None |
| A0A3Q0KH29 | 32-118 | None |
| A0A6A4WL29 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.