DPCstruct | MC13687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 18.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A841EQU8 | 2-136 | TNCKNCNSHFEGNFCNECGQAADTHEINSHFLWHDIQQGLLNLDKGILFTLKELSTRPGYSIKEFIAGRRVQHFKPISFVLVVAGIY… |
| A0A520DJP0 | 6-136 | YRKEHNCLNCGFHVESHYCSSCGQPNLELKESFWGFISHSIAHYFHFDNKFFQTLTPLLTKPGQVTLDYLAGKRARYINPVSMYIFV… |
| A0A2R7RX91 | 22-146 | None |
| A0A4V1ULL8 | 5-120 | None |
| A0A7D5S5J4 | 10-108 | None |
| A0A267TAM4 | 1-134 | None |
| A0A7W0NST8 | 1-124 | None |
| A0A2V5YNA4 | 25-179 | None |
| A0A2E9JIC7 | 1-106 | None |
| A0A4Q3A476 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.