DPCstruct | MC13683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 8.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5C3A6 | 1-97 | MSATGLSLRCGDCGVLLKSVEEAQEHAELTSHSNFSESTEAVLNLVCTVCRKPCRSKTETDLHTKRTGHSDFSDLTSETAKPISLDP… |
| A0A5B6WT95 | 27-141 | MAGVSLKCGDCGALLKSVEEAQEHAELTSHSNFSESTEAVLNLVCSSCGKPCRSKVESDLHTKRTGHTEFIDKTLEAAIPISLEVPK… |
| A0A1D6Q273 | 1-107 | None |
| A0A2G3AVC7 | 1-108 | None |
| A0A7S2MEI3 | 5-120 | None |
| A0A1R3J198 | 1-106 | None |
| A0A0D2RDZ0 | 1-108 | None |
| A0A3Q7JD82 | 172-282 | None |
| A0A0Q3I140 | 1-106 | None |
| A0A2P6V2J8 | 113-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.