DPCstruct | MC13682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S2NE54 | 112-229 | TNARACKSLGHQYVVQLGRIYLDMLNIYNVMSANITDAIATNGDSVTKQPLIKNMRVIKKETLRLISDWISRSNDNAMVLENFIPPL… |
| A0A6N2N007 | 13-97 | TNTSAASSLGTYFLSQISLIFLDMLNVYRMYSELISSSIAEGGPYASKTSYVKLLRSVKRETLKLIETFLDKAEDQPQIGKQFVP |
| A0A396GK11 | 129-245 | None |
| A0A453MKR8 | 1-118 | None |
| A0A0A9DER1 | 238-354 | None |
| A0A287T2D8 | 219-335 | None |
| A0A287T288 | 122-238 | None |
| A0A1I7X0S0 | 298-412 | None |
| A0A226D4G4 | 736-854 | None |
| A0A6A2Z5T4 | 134-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.