DPCstruct | MC13681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 193 ± 21 aa |
| Standard deviation of domain lengths | 20.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7KCS1 | 1-134 | RSREEEERLAGRMVLNAVAAACELNDRLELELLEGERVEESRVRAPREWRELLLGAAESVRIGPNIGAPRLVFPGAFNPLHSGHRRM… |
| A0A5B6WPW3 | 7-211 | VLGVGFTGSLATTCPKQGDHRFHLSTRTSDRHWASTVTLSKGLRSRDQEEKVSSYFLLKAIANACKVSSTFDSELTESDVVADECER… |
| A0A2U1NI52 | 89-287 | None |
| A0A0D2RI58 | 95-274 | None |
| A0A7K0RX45 | 89-279 | None |
| A0A7J6XCY9 | 94-285 | None |
| A0A843UE78 | 2-195 | None |
| M8AL71 | 259-450 | None |
| A0A812IP46 | 845-1040 | None |
| A0A7R9TVV2 | 1-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.