DPCstruct | MC13675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 212 ± 35 aa |
| Standard deviation of domain lengths | 34.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2F107 | 3-195 | GISATTLKIIGMIAMTIDHIGYFLFPQIEAFRIIGRIAYPIFAYMIAEGCRYTRNKVKYLLSVLGVGCGCSAVSYITEGSLYQSILI… |
| A0A1A9M9J5 | 6-215 | REFLKWLAAAFMTGDHVLKILAIGYVPVVTELGRVAFPLFALVLAYNLAQPKADVEKSVKRLFLWGLIATPVAAIAFQRVFPLNVLL… |
| A0A2A4QU23 | 23-258 | None |
| D0BL26 | 7-247 | None |
| A0A1V5GP52 | 10-259 | None |
| A0A4Q5EYG4 | 1-228 | None |
| A0A650MUU4 | 1-186 | None |
| T2RFZ4 | 1-149 | None |
| A0A847CBA8 | 11-238 | None |
| A0A5C9B160 | 225-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.