DPCstruct | MC13673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 300 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 20.45 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.97 |
| Pfam Score | 87.56 |
| Assigned Pfam label(s) | PF11042- PF07179- PF11360 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1YE04 | 74-203 | GQYTGSVGDLINNYRNGEIEESKFYESLGDVVLYYADPTGVDREGNTADYTLPAAEGCRYLPVFDSYAHTRNYYVEEGRVRITIKRE… |
| A0A413WQT6 | 55-164 | VTQAESDVLETFCERVEENGLVFGLSAEQDEGWAYAPSHVEDTDVLLFFSSRELALACRVKEWADYHVIELPVELFLERWLPNMSDD… |
| A0A101S9T1 | 79-192 | None |
| A0A2A2SDV1 | 136-261 | None |
| A0A4Q9KD30 | 128-267 | None |
| A0A2A3ITV8 | 192-337 | None |
| A0A6J4H583 | 41-140 | None |
| A0A838JVG4 | 25-164 | None |
| A0A0N0MNG1 | 3-123 | None |
| A0A1G6GMH2 | 407-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.