DPCstruct | MC13670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 186 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L4PN49 | 254-441 | LSYPQHQEDWHLAPRVMAKMITVENTPFSAEGIQIAKAVVDVCLEHGNTPSPCVFPAWEGELFGWKVRVSVVEPEENTKLCGPAYLN… |
| A0A7L4RSR5 | 25-194 | TDEQIAEFLTFDRSPSSDIGMNVMNGTSRAILQYGHKNAPYRIKAFEKQFTENRMEVYLFANDGTLCGKDVLNVLYVFDGAVYSVPP… |
| A0A7L4R4P4 | 1-145 | None |
| A0A1V5V7L3 | 456-636 | None |
| A0A7J4EXJ2 | 85-288 | None |
| A0A832UAW2 | 52-242 | None |
| C7P7M1 | 341-539 | None |
| A0A1D2R9F6 | 146-342 | None |
| A0A497RWC3 | 277-484 | None |
| A0A850MLS4 | 1-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.