DPCstruct | MC13669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Standard deviation of domain lengths | 17.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842UCT3 | 175-297 | YVLVVVIVALLGLLYFFMMPANCGEDSACFIAYANDCENAVMSKTLGTAVFKFRTNDCVLEKEIIGFSEAEPDAVKNLFTGLKMECS… |
| A0A7L4RSU3 | 21-139 | APDGTNANLKDCGSNLTCFNNAFSACEPAKVQNTDTDGDITTTLYGEVKGGTASNCTIYMKINDISVSANASDQEKLAMFIKGADMT… |
| A0A7J2IZI5 | 9-121 | None |
| A0A522E014 | 522-629 | None |
| A0A2H0RBY9 | 54-201 | None |
| E4TSQ1 | 559-669 | None |
| A0A842UXD1 | 33-155 | None |
| A0A842V0T6 | 212-356 | None |
| A0A2M7VJZ5 | 191-321 | None |
| A0A2G9MGC4 | 12-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.