DPCstruct | MC13668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 386 ± 51 aa |
| Standard deviation of domain lengths | 51.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495WK51 | 153-479 | DRRDVEVFARAKQREDSAVPPDGITALADALALGKAVRELEDRLPKADLHRGLGQTDAAKAELKLLADSGRAADLGTYFRRAHAFLE… |
| A0A7L4RIN0 | 724-1114 | KDSDVIISLIVEKMGTPNENSIPILLELLENPASKVKMSDEFAEKFQKAMAIFAEQDNDDAQRALHIFEHLAGQKKLKPEILDLVIL… |
| A0A2M7U1G1 | 123-525 | None |
| A0A075GSL1 | 2-399 | None |
| A0A2M8G019 | 220-603 | None |
| A0A388T8U4 | 73-531 | None |
| A0A7W1MC38 | 46-396 | None |
| A0A0S7XQL0 | 33-458 | None |
| A0A075GUX7 | 11-399 | None |
| A0A5E4IN08 | 35-544 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.