DPCstruct | MC13667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 12.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L4RHD2 | 12-86 | AFMSAGCLEQMEGIGEKYCAGDSDCACGVHKTTEQCFYGNKQYVDMTKQCPDFCTGIAGNLDVKCVDFVCTQVRV |
| A0A7J3LK28 | 97-157 | LGEKECLDDLDCACGRHIVSDDCFVGNNRFVNSGKQCPDYCTGIDGNIKVKCLSGECRLVR |
| A0A7J3CTP5 | 28-102 | None |
| A0A2M6T0S5 | 92-160 | None |
| A0A2G9M6W9 | 14-110 | None |
| A0A7C5X9Z3 | 258-347 | None |
| A0A5E4HJL1 | 256-322 | None |
| A0A2H6A8M5 | 13-99 | None |
| A0A7C2ZH68 | 216-310 | None |
| A0A1J4WUX5 | 542-605 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.