DPCstruct | MC13664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 196 ± 30 aa |
| Standard deviation of domain lengths | 30.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1B3G8 | 2-193 | LDRPAFWAVHLGLALGDGLDAALAALFGVPLGLLRGTYLRLTDDDGQPEFTVAAALAIRYRRQDVRYLLLPPDDEPIVLGVAEGVPD… |
| A0A845PAZ7 | 1-144 | TLTLPIGSDIVLTIEFHPCCTYYFLNDTLIGEVSGNFHLKYLTYSELMRITKEKYGDVLFHLLLPLSAIREQEKGIALNAIIQRLQQ… |
| A0A2N0GNF6 | 60-231 | None |
| A0A4R4AE83 | 3-149 | None |
| A0A2S8FB72 | 9-217 | None |
| A0A2T0LA62 | 145-338 | None |
| A0A2Z5JSB2 | 10-239 | None |
| A0A328NUT5 | 4-218 | None |
| A0A2T4ZBY1 | 137-344 | None |
| A0A833PDJ6 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.