DPCstruct | MC13663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A3JXK6 | 97-213 | SIRSCPEHGCMLVSLPPEKFSKDARDYSAQLRKHYGWILDQPMVPAELSPFEQYLTDRILKGRGDRWIDRLELNVVSRACEVLGLRI… |
| A0A0Q6QGN3 | 1-152 | MSSRLLVDAAIAPTVEWSGWAGPIRVCREHGVMLVGLKPHPAPELTHDFASKLAFERQIIPNLAETAFGMEPDSLQGYVEGRMRCGP… |
| A0A238L347 | 7-132 | None |
| A0A369U7U4 | 123-245 | None |
| A0A6G9W876 | 168-285 | None |
| A0A7W6ILX3 | 2-117 | None |
| A0A1I3F339 | 1-122 | None |
| A0A2U8W029 | 299-422 | None |
| B6BD70 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.