DPCstruct | MC13661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 152 ± 19 aa |
| Standard deviation of domain lengths | 19.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5DVE6 | 671-830 | GSGFRYGQSGYGRQSTGGCGFWNADADWANGTALPTINSTVTGAISQAGIGNAKVLDLASTFNGRRLCESGVGLYEEVGLPSWQSAG… |
| A0A7U9L2F1 | 1-167 | MRYPGEKYDRLTQGGCPFFDEDLTWAHDALVPQISTTLAAAARTGGAEFLDLSRAFEGREVCSDSTVQAGPGQQPSGSTSEWARFVT… |
| A0A841CZ66 | 546-700 | None |
| A0A1S2PLA0 | 7-135 | None |
| A0A7X9KL99 | 1-140 | None |
| A0A7W0H984 | 1-153 | None |
| A0A6G3PEG1 | 511-662 | None |
| A0A229H455 | 630-807 | None |
| A0A1B6AVR8 | 233-409 | None |
| A0A1H5ATL9 | 148-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.