DPCstruct | MC1366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 156 ± 23 aa |
| Standard deviation of domain lengths | 22.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 87.88 |
| Assigned Pfam label(s) | PF13382- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5NX62 | 11-169 | SVRVIVVRDGSLATDEAVYELPIEGGYVRPEPELDVLQVAVVERHGKRGGVGVGFVSGFGLRRGAVASTYAHDSHNVVVVGASWSDM… |
| A0A484ZRW7 | 45-211 | RLTPRRLQDFELRIPDIINGKAKLRIIKGARFTQWSEITLDVRNGIALVPEGYSLIYVQHRHGRHQLGAQLAVLEDWGEMKGAIATT… |
| W5T1P8 | 1-128 | None |
| A0A3S4LJX3 | 8-164 | None |
| A0A1U9Z648 | 30-157 | None |
| A0A1Q9BVH6 | 175-379 | None |
| A0A7W8FXH0 | 532-681 | None |
| R1EPQ5 | 78-243 | None |
| A0A3R6N4Q1 | 402-560 | None |
| A0A5S9M778 | 3-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.