DPCstruct | MC13659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H2JAZ9 | 6-99 | MTPPLEPSCPDCHAGIGHVHLEGCDVARCLATGLQRLGHDETCQCPQDTWSGLWPGEAECIEFGWVYGPGLPDLNRLMTTATWDPVT… |
| A0A7U9KUV1 | 119-222 | QPAPNAACPACSTPPGTLHADHCDIARCALTGRQRDTCHPANVCNTIWTGHYPGVTECAEYGFYCRYGLDGYKPCNADDPDAHHDLN… |
| A0A1H9T513 | 7-119 | None |
| A0A1G8EAE0 | 94-187 | None |
| A0A1C6VWA0 | 12-132 | None |
| A0A1H9WQN7 | 136-233 | None |
| A0A495QWV3 | 26-134 | None |
| A0A1I5DZQ8 | 6-100 | None |
| A0A2T0KPW0 | 5-117 | None |
| E3IX36 | 50-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.