DPCstruct | MC13655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 154 ± 14 aa |
| Standard deviation of domain lengths | 13.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2TVL0 | 104-242 | LKRGVIKAIATIQDNESLSPTKVVDCLVSLLKDNDNGRNLYSDCYYLHDLILCLGKIRLSRTESPEKIWDQLSRYLEYDRVLPSYRN… |
| A0A2U4B340 | 538-685 | LQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITR… |
| A0A0S7JDC8 | 54-205 | None |
| A0A453KT37 | 606-745 | None |
| A0A811UXL3 | 4-165 | None |
| A0A820X6V3 | 438-596 | None |
| A0A498M1I2 | 8-171 | None |
| A0A820T1X3 | 61-219 | None |
| A0A821ZEZ7 | 1-190 | None |
| A0A5J4Y2X2 | 109-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.